Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ELAVL4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15740220UL
Description
ELAVL4 Polyclonal specifically detects ELAVL4 in Human samples. It is validated for Western Blot.Specifications
ELAVL4 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P26378 | |
ELAVL4 | |
Synthetic peptides corresponding to ELAVL4(ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)) The peptide sequence was selected from the N terminal of ELAVL4. Peptide sequence MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEI | |
20 μL | |
Neuroscience, Vision | |
1996 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
abnormal vision, Drosophila, homolog of, like-4, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D), HuD, Paraneoplastic encephalomyelitis antigen HuD | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title