ELAVL4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157402

Catalog No. NBP157402

Description

ELAVL4 Polyclonal specifically detects ELAVL4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ELAVL4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P26378
• Gene Symbols: ELAVL4
• Immunogen: Synthetic peptides corresponding to ELAVL4(ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)) The peptide sequence was selected from the N terminal of ELAVL4. Peptide sequence MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: Neuroscience, Vision
• Gene ID (Entrez): 1996
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: abnormal vision, Drosophila, homolog of, like-4, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D), HuD, Paraneoplastic encephalomyelitis antigen HuD
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Chicken: 92%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG