Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Elf4/MEF Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310428100UL
Description
Elf4/MEF Polyclonal specifically detects Elf4/MEF in Mouse samples. It is validated for Western Blot.Specifications
Elf4/MEF | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
E74-like factor 4, E74-like factor 4 (ets domain transcription factor), ETS-related transcription factor Elf-4, MEFELFRMyeloid Elf-1-like factor | |
The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_062654). Peptide sequence DDLKKTSDAGDQKEHSEEEKVSREENLRKMGKARKRNRKTKNNRSTSPVT | |
100 μg | |
Cancer | |
2000 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction