Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Elf4/MEF Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen Elf4/MEF
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125757
View Documents
Novus Biologicals
NBP310428100UL
100 μg
Each for $352.89
Add to cart
 
NB125758
View Documents
Novus Biologicals
NBP31042825UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

Elf4/MEF Polyclonal antibody specifically detects Elf4/MEF in Mouse samples. It is validated for Western Blot
Specifications

Specifications

Elf4/MEF
Western Blot
Purified
RUO
Mouse
E74-like factor 4, E74-like factor 4 (ets domain transcription factor), ETS-related transcription factor Elf-4, MEFELFRMyeloid Elf-1-like factor
The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_062654). Peptide sequence DDLKKTSDAGDQKEHSEEEKVSREENLRKMGKARKRNRKTKNNRSTSPVT
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Cancer
PBS buffer, 2% sucrose
2000
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit