Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ELFN2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
$382.00 - $610.00
Specifications
| Antigen | ELFN2 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ELFN2 Polyclonal specifically detects ELFN2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| ELFN2 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 114794 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| dJ63G5.3, dJ63G5.3 (putative Leucine rich protein), ELFN2, extracellular leucine-rich repeat and fibronectin type III containing 2, extracellular leucine-rich repeat and fibronectin type III domain containing 2, extracellular leucine-rich repeat and fibronectin type III domain-containing protein 2, KIAA1904, leucine rich repeat containing 62, leucine-rich repeat and fibronectin type-III domain-containing protein 6, leucine-rich repeat-containing protein 62, LRRC62, protein phosphatase 1, regulatory subunit 29 | |
| ELFN2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title