Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ELFN2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP191363
Description
ELFN2 Polyclonal specifically detects ELFN2 in Human samples. It is validated for Western Blot.Specifications
ELFN2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
dJ63G5.3, dJ63G5.3 (putative Leucine rich protein), ELFN2, extracellular leucine-rich repeat and fibronectin type III containing 2, extracellular leucine-rich repeat and fibronectin type III domain containing 2, extracellular leucine-rich repeat and fibronectin type III domain-containing protein 2, KIAA1904, leucine rich repeat containing 62, leucine-rich repeat and fibronectin type-III domain-containing protein 6, leucine-rich repeat-containing protein 62, LRRC62, protein phosphatase 1, regulatory subunit 29 | |
Rabbit | |
Affinity purified | |
RUO | |
114794 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_443138 | |
ELFN2 | |
Synthetic peptide directed towards the N terminal of human ELFN2. Peptide sequence PVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHH. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Rat: 100%; Bovine: 92%. | |
Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction