Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ELFN2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19136320UL

 View more versions of this product

Catalog No. NBP19136320


Add to cart

Description

Description

ELFN2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ELFN2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
ELFN2
Synthetic peptide directed towards the N terminal of human ELFN2. Peptide sequence PVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHH.
Immunogen affinity purified
RUO
Primary
114794
Western Blot
Western Blot 1:1000
NP_443138
dJ63G5.3, dJ63G5.3 (putative Leucine rich protein), ELFN2, extracellular leucine-rich repeat and fibronectin type III containing 2, extracellular leucine-rich repeat and fibronectin type III domain containing 2, extracellular leucine-rich repeat and fibronectin type III domain-containing protein 2, KIAA1904, leucine rich repeat containing 62, leucine-rich repeat and fibronectin type-III domain-containing protein 6, leucine-rich repeat-containing protein 62, LRRC62, protein phosphatase 1, regulatory subunit 29
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit