Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ELMOD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ELMOD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179667
|
Novus Biologicals
NBP179667 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ELMOD1 Polyclonal specifically detects ELMOD1 in Human samples. It is validated for Western Blot.Specifications
| ELMOD1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| NP_001123509 | |
| 55531 | |
| Synthetic peptide directed towards the middle region of human ELMOD1The immunogen for this antibody is ELMOD1. Peptide sequence CYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKI. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp547C176, ELMO domain containing 1, ELMO domain-containing protein 1, ELMO/CED-12 domain containing 1 | |
| ELMOD1 | |
| IgG | |
| Affinity Purified | |
| 36 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title