Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ELMOD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15486220UL

Catalog No. NBP15486220

Add to cart



ELMOD1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptides corresponding to LANCL2(LanC lantibiotic synthetase component C-like 2 (bacterial)) The peptide sequence was selected form the middle region of LANCL2. Peptide sequence EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK.
Immunogen affinity purified
Western Blot
Western Blot
G protein-coupled receptor 69B, GPR69B, LanC (bacterial lantibiotic synthetase component C)-like 2, LanC lantibiotic synthetase component C-like 2 (bacterial), lanC-like protein 2, TASPMGC87139, Testis-specific adriamycin sensitivity protein
20 ul
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit