Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ELOF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | ELOF1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17982220
|
Novus Biologicals
NBP17982220UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP179822
|
Novus Biologicals
NBP179822 |
100 μL |
Each for $482.50
|
|
|||||
Description
ELOF1 Polyclonal specifically detects ELOF1 in Human samples. It is validated for Western Blot.Specifications
| ELOF1 | |
| Polyclonal | |
| Rabbit | |
| NP_115753 | |
| 84337 | |
| Synthetic peptide directed towards the middle region of human ELOF1The immunogen for this antibody is ELOF1. Peptide sequence SCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ELF1, elongation factor 1 homolog (ELF1, S. cerevisiae), elongation factor 1 homolog (S. cerevisiae), MGC4549, transcription elongation factor 1 homolog | |
| ELOF1 | |
| IgG | |
| 9 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title