Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Elp4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | Elp4 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB126163
|
Novus Biologicals
NBP310631100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
Elp4 Polyclonal specifically detects Elp4 in Human samples. It is validated for Western Blot.Specifications
| Elp4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| C11orf19, chromosome 11 open reading frame 19, dJ68P15A.1, elongation protein 4 homolog (S. cerevisiae), elongator complex protein 4, hELP4, PAX6 neighbor gene protein, PAX6NEB, PAXNEBFLJ20498 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human Elp4. Peptide sequence TMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIR | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 26610 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title