Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Emerin Mouse anti-Human, Clone: 5A10, Invitrogen™

Mouse Monoclonal Antibody

Manufacturer:  Invitrogen MA527874

Catalog No. PIMA527874


Add to cart

Description

Description

The synthetic peptide sequence is 1-48aa, MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL Product may be stored at -20C for one year. After reconstitution, at 4C for one month. Product can also be aliquotted and stored frozen at -20C for a longer time. Avoid repeated freezing and thawing. Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.

Emerin is a serine rich protein ubiquitously expressed with highest concentration in skeletal and cardiac muscles. It is localized in the nuclear membrane and is coded by STA gene at Xq28 locus. Emerin deficiency is tye main causal feature of Emery-Dreifuss muscular dystrophy (EDMD), which is a X-linked disorder leading to weakening of muscles and cardiomyopathy presented as heart block.
Specifications

Specifications

Emerin
Monoclonal
Unconjugated
EMD
Lyophilized
EMD
A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin.
Antigen affinity chromatography
RUO
Antibody
Monoclonal
Human
Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin)
5A10
PBS with 4MG trehalose, 4MG trehalose and 0.05MG sodium azide, 0.05MG sodium azide
P50402
Emerin, EMD, EDMD, STA
Mouse
IgG1
100 μg
-20°C
Primary
2010
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit