Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EMI1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15505020UL
Description
EMI1 Polyclonal specifically detects EMI1 in Human samples. It is validated for Western Blot.Specifications
EMI1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9UKT4 | |
FBXO5 | |
Synthetic peptides corresponding to FBXO5(F-box protein 5) The peptide sequence was selected from the C terminal of FBXO5. Peptide sequence ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL. | |
Affinity Purified | |
RUO | |
26271 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
EMI1Early mitotic inhibitor 1, F-box only protein 5, F-box protein 5, FBX5F-box protein Fbx5, Fbxo31 | |
Rabbit | |
50 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title