Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EMI1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | EMI1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15505020
|
Novus Biologicals
NBP15505020UL |
20 μL |
Each for $152.22
|
|
NBP155050
|
Novus Biologicals
NBP155050 |
100 μL |
Each for $436.00
|
|
Description
EMI1 Polyclonal specifically detects EMI1 in Human samples. It is validated for Western Blot.Specifications
| EMI1 | |
| Polyclonal | |
| Rabbit | |
| Q9UKT4 | |
| 26271 | |
| Synthetic peptides corresponding to FBXO5(F-box protein 5) The peptide sequence was selected from the C terminal of FBXO5. Peptide sequence ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EMI1Early mitotic inhibitor 1, F-box only protein 5, F-box protein 5, FBX5F-box protein Fbx5, Fbxo31 | |
| FBXO5 | |
| IgG | |
| Affinity Purified | |
| 50 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title