Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EMMPRIN/CD147 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP257810
Description
EMMPRIN/CD147 Polyclonal specifically detects EMMPRIN/CD147 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
EMMPRIN/CD147 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
5F7, basigin, basigin (Ok blood group), CD147, CD147 antigen, Collagenase stimulatory factor, EMMPRINTCSF, Extracellular matrix metalloproteinase inducer, Leukocyte activation antigen M6, M6, OK, OK blood group antigen, Tumor cell-derived collagenase stimulatory factor | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
BSG | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGT | |
100 μL | |
Cancer, Signal Transduction, Vision | |
682 | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction