Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EMP/MAEA Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP310675100UL

 View more versions of this product

Catalog No. NB126251


Add to cart

Description

Description

EMP/MAEA Polyclonal specifically detects EMP/MAEA in Human samples. It is validated for Western Blot.
Specifications

Specifications

EMP/MAEA
Unconjugated
PBS buffer, 2% sucrose
EMLP, EMPCell proliferation-inducing gene 5 protein, Erythroblast macrophage protein, HLC-10, Human lung cancer oncogene 10 protein, lung cancer-related protein 10, macrophage erythroblast attacher, PIG5, proliferation-inducing gene 5
The immunogen is a synthetic peptide directed towards the N-terminal region of Human EMP/MAEA. Peptide sequence KAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHL
100 μg
Apoptosis
Primary
10296
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit