Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Endophilin A1/SH3GL2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Endophilin A1/SH3GL2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179629
View Documents
Novus Biologicals
NBP179629
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

Endophilin A1/SH3GL2 Polyclonal specifically detects Endophilin A1/SH3GL2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Endophilin A1/SH3GL2
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
CNSA2FLJ25015, EEN-B1bA335L15.1 (SH3-domain GRB2-like 2), Endophilin-1, endophilin-A1, FLJ20276, SH3 domain protein 2A, SH3 domain-containing GRB2-like protein 2, SH3D2AEndophilin A1 BAR domain, SH3-domain GRB2-like 2, SH3P4endophilin-1
SH3GL2
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
NP_003017
6456
Synthetic peptide directed towards the middle region of human SH3GL2The immunogen for this antibody is SH3GL2. Peptide sequence PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit