Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Endothelin 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17947520UL
Description
Endothelin 2 Polyclonal specifically detects Endothelin 2 in Human samples. It is validated for Western Blot.Specifications
Endothelin 2 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001947 | |
EDN2 | |
Synthetic peptide directed towards the n terminal of human EDN2. Peptide sequence MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCS. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
endothelin 2, endothelin-2, ET2, ET-2, PPET2, preproendothelin 2, Preproendothelin-2 | |
Rabbit | |
20 kDa | |
20 μL | |
Signal Transduction | |
1907 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title