ENO1 Recombinant Protein, Abnova Available on GSA/VA Contract for Federal Government customers only.

Human ENO1 full-length ORF recombinant protein with GST-tag at N-terminal

Manufacturer: Abnova Corporation H00002023P0125

 View more versions of this product

Catalog No. 89-010-065

  N/A
Add to Cart
  Our pricing system is currently unavailable. You are viewing list price.
You can save item(s) to your list now to purchase when our pricing system is available.

    Specifications

    Cross Reactivity Human
    For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blotting (Recombinant Protein)
    Format Solution
    Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
    Molecular Weight 73.48
    Name Human ENO1 Full-length ORF Recombinant Protein with GST-tag at N-terminal
    pH Range 8
    Preparation Method In vitro wheat germ expression system
    Purification Method Glutathione Sepharose 4 Fast Flow
    Quality Control Testing 12.5% SDS-PAGE stained with Coomassie Blue
    Quantity 25μg
    Recombinant Yes
    Source Wheat Germ (in vitro)
    Storage Requirements -80°C

    This gene encodes one of three enolase isoenzymes found in mammals; it encodes alpha-enolase, a homodimeric soluble enzyme, and also encodes a shorter monomeric structural lens protein, tau-crystallin. The two proteins are made from the same message. The full length protein, the isoenzyme, is found in the cytoplasm. The shorter protein is produced from an alternative translation start, is localized to the nucleus, and has been found to bind to an element in the c-myc promoter. A pseudogene has been identified that is located on the other arm of the same chromosome.

    • Molecular Weight: 73.48kDa
    • Preparation Method: in vitro wheat germ expression system
    • Purification: Glutathione Sepharose 4 Fast Flow
    • Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8.0 in the elution buffer

    Sequence: MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNL
    KNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEGLGSKAKFAGRNFRNPLAK

    Best when used within three months from the date of receipt.

    ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit