Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ENPP-2/Autotaxin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159852
Description
ENPP-2/Autotaxin Polyclonal specifically detects ENPP-2/Autotaxin in Human samples. It is validated for Western Blot.Specifications
ENPP-2/Autotaxin | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
ATXFLJ26803, ATX-X, AUTOTAXIN, autotaxin-t, EC 3.1.4.39, ectonucleotide pyrophosphatase/phosphodiesterase 2, ectonucleotide pyrophosphatase/phosphodiesterase family member 2, E-NPP 2, Extracellular lysophospholipase D, LysoPLD, PD-IALPHA, PDNP2NPP2, phosphodiesterase I/nucleotide pyrophosphatase 2, plasma lysophospholipase D | |
Rabbit | |
95 kDa | |
100 μL | |
Cardiovascular Biology | |
5168 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q13822 | |
ENPP2 | |
Synthetic peptides corresponding to ENPP2 (ectonucleotide pyrophosphatase/phosphodiesterase 2) The peptide sequence was selected from the N terminal of ENPP2)(50ug). Peptide sequence YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction