Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ENPP-2/Autotaxin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ENPP-2/Autotaxin |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159852
|
Novus Biologicals
NBP159852 |
100 μL |
Each of 1 for $436.00
|
|
Description
ENPP-2/Autotaxin Polyclonal specifically detects ENPP-2/Autotaxin in Human samples. It is validated for Western Blot.Specifications
ENPP-2/Autotaxin | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ATXFLJ26803, ATX-X, AUTOTAXIN, autotaxin-t, EC 3.1.4.39, ectonucleotide pyrophosphatase/phosphodiesterase 2, ectonucleotide pyrophosphatase/phosphodiesterase family member 2, E-NPP 2, Extracellular lysophospholipase D, LysoPLD, PD-IALPHA, PDNP2NPP2, phosphodiesterase I/nucleotide pyrophosphatase 2, plasma lysophospholipase D | |
ENPP2 | |
IgG | |
Affinity Purified | |
95 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q13822 | |
5168 | |
Synthetic peptides corresponding to ENPP2 (ectonucleotide pyrophosphatase/phosphodiesterase 2) The peptide sequence was selected from the N terminal of ENPP2)(50ug). Peptide sequence YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title