Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ENTHD2 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310714100UL
Description
ENTHD2 Polyclonal specifically detects ENTHD2 in Rat samples. It is validated for Western Blot.Specifications
ENTHD2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
AP-4 Accessory Protein, AP-4 Complex Accessory Subunit Tepsin, C17orf56, Chromosome 17 Open Reading Frame 56, ENTH Domain Containing 2, ENTH Domain-Containing Protein 2, Epsin For AP-4, TEPSIN, TEPSIN, Adaptor Related Protein Complex 4 Accessory Protein, Tetra-Epsin | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1307410 (XP_340947). Peptide sequence LSFLHRLPILLKGTSDDDIPCPGYLFEEIAKISHESLGSSQCLLEYLLNR | |
100 μg | |
Primary | |
Rat | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
146705 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction