Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EpCAM (CD326) Polyclonal Antibody
EpCAM (CD326) Polyclonal Antibody
Supplier: Thermo Scientific PA579207
Description
EpCAM (CD326) Polyclonal Antibody for Western Blot, ICC/IF, IHC (F), IHC (P), Flow, ELISA

Specifications
EpCAM (CD326) | |
Polyclonal | |
Unconjugated | |
EPCAM | |
adenocarcinoma-associated antigen; CD326; cell surface glycoprotein Trop-1; DIAR5; EGP; EGP-2; EGP314; EGP40; EPCAM; Ep-CAM; EpCAM1; epithelial cell adhesion molecule; Epithelial cell surface antigen; Epithelial glycoprotein; Epithelial glycoprotein 314; ESA; GA733-2; gp40; hEGP314; HNPCC8; human epithelial glycoprotein-2; KS 1/4 antigen; KS1/4; KSA; Ly74; lymphocyte antigen 74; M1S2; M4S1; major gastrointestinal tumor-associated protein GA733-2; mEGP314; membrane component, chromosome 4, surface marker (35kD glycoprotein); MIC18; MK-1; panepithelial glycoprotein 314; protein 289A; Protein D5.7A; Tacsd1; Tacstd1; TROP1; Trop-1 protein; Tumor-associated calcium signal transducer 1 | |
Rabbit | |
Antigen Affinity Chromatography | |
RUO | |
4072 | |
-20°C | |
Lyophilized |
ELISA, Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot | |
500 μg/mL | |
PBS with 4mg trehalose and no preservative | |
P16422 | |
EPCAM | |
A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN). | |
100 μg | |
Primary | |
Human | |
Antibody | |
IgG |
Safety and Handling
WARNING: Cancer - www.P65Warnings.ca.gov
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction