EphA4 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198363

Catalog No. NBP198363

Description

EphA4 Polyclonal specifically detects EphA4 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EphA4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Accession No.: NP_031962
• Gene Symbols: EPHA4
• Immunogen: The immunogen for this antibody is Eph receptor A4. Peptide sequence VISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEID.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2043
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.10, EC 2.7.10.1, EK8, EPH receptor A4, EphA4, EPH-like kinase 8, ephrin type-A receptor 4, HEK8, receptor protein-tyrosine kinase HEK8, SEK, TYRO1, TYRO1 protein tyrosine kinase, Tyrosine-protein kinase receptor SEK, Tyrosine-protein kinase TYRO1
• Host Species: Rabbit
• Molecular Weight of Antigen: 110 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.