Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ERAS Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ERAS |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179602
|
Novus Biologicals
NBP179602 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ERAS Polyclonal specifically detects ERAS in Mouse samples. It is validated for Western Blot.Specifications
| ERAS | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Embryonic stem cell-expressed Ras, E-Ras, ES cell expressed Ras, HRAS2MGC126693, HRASPGTPase ERas, MGC126691, small GTPase protein E-Ras, v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2, v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene | |
| ERAS | |
| IgG | |
| Affinity Purified | |
| 25 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_853526 | |
| 3266 | |
| Synthetic peptide directed towards the N terminal of human ErasThe immunogen for this antibody is Eras. Peptide sequence LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title