Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals ErbB2/Her2 Protein
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Manufacturer: Novus Biologicals NBP184584PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERBB2. The ErbB2/Her2 Recombinant Protein Antigen is derived from E. coli. The ErbB2/Her2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP1-84584. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Specifications
0.5mg/mL | |
PBS and 1M Urea, pH 7.4. | |
31kDa | |
>80% | |
E.Coli | |
Store at -20°C. Avoid freeze-thaw cycles. | |
ERBB2 | |
Unlabeled | |
Yes |
Blocking/Neutralizing, Control | |
2064 | |
Chromatography | |
0.1mL | |
LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA | |
RUO | |
ErbB2/Her2 | |
Human |
Safety and Handling
ShelfLife : 365
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only