Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ERMAP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen ERMAP
Immunogen Synthetic peptides corresponding to ERMAP(erythroblast membrane-associated protein (Scianna blood group)) The peptide sequence was selected from the middle region of ERMAP. Peptide sequence PANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFY
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16251320 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16251320UL
20ul Each for $149.00
Add to cart
 
NBP162513 View Documents Novus BiologicalsSupplier Diversity Partner
NBP162513
100 ul Each for $329.00
Add to cart
 
Description

Description

ERMAP Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ERMAP
Rabbit
Polyclonal
Unconjugated
114625
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to ERMAP(erythroblast membrane-associated protein (Scianna blood group)) The peptide sequence was selected from the middle region of ERMAP. Peptide sequence PANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFY
Primary
IgG
erythroblast membrane-associated protein, erythroblast membrane-associated protein (RD and SC blood groups), erythroblast membrane-associated protein (Scianna blood group), erythroid membrane-associated protein, hERMAP, MGC118810, MGC118811, PRO2801, Radin blood group, Radin blood group (Rd), Radin blood group antigen, RDMGC118812, Scianna blood group, Scianna blood group (Sc), Scianna blood group antigen, SCMGC118813
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit