Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ESF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310692100UL
Description
ESF1 Polyclonal specifically detects ESF1 in Human samples. It is validated for Western Blot.Specifications
ESF1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
ABT1-associated protein, ABTAP, bA526K24.1, C20orf6, chromosome 20 open reading frame 6, ESF1 homolog, ESF1, nucleolar pre-rRNA processing protein, homolog (S. cerevisiae), FLJ20368 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ESF1 (NP_057733). Peptide sequence QELTQAIKKKESEIEKESQRKSIDPALSMLIKSIKTKTEQFQARKKQKVK | |
100 μg | |
Stem Cell Markers | |
51575 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction