Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ETV2/ER71 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310400100UL
Description
ETV2/ER71 Polyclonal specifically detects ETV2/ER71 in Mouse samples. It is validated for Western Blot.Specifications
ETV2/ER71 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
ER71MGC129835, ETS translocation variant 2, ets variant 2, Ets-related protein 71, ETSRP71ets variant gene 2, MGC129834 | |
The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_031985). Peptide sequence MDLWNWDEASLQEVPPGDKLTGLGAEFGFYFPEVALQEDTPITPMNVEGC | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
2116 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction