Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EVER2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | EVER2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157812
|
Novus Biologicals
NBP157812 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
EVER2 Polyclonal specifically detects EVER2 in Human samples. It is validated for Western Blot.Specifications
| EVER2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8IU68 | |
| 147138 | |
| Synthetic peptides corresponding to TMC8 (transmembrane channel-like 8) The peptide sequence was selected from the N terminal of TMC8)(50ug). Peptide sequence PGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| epidermodysplasia verruciformis 2, Epidermodysplasia verruciformis protein 2, EV2, EVER2MGC102701, EVIN2FLJ43684, FLJ40668, MGC40121, transmembrane channel-like 8, transmembrane channel-like protein 8 | |
| TMC8 | |
| IgG | |
| Affinity Purified | |
| 82 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title