Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EVER2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen EVER2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157812
View Documents
Novus Biologicals
NBP157812
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

EVER2 Polyclonal specifically detects EVER2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

EVER2
Polyclonal
Rabbit
Human
Q8IU68
147138
Synthetic peptides corresponding to TMC8 (transmembrane channel-like 8) The peptide sequence was selected from the N terminal of TMC8)(50ug). Peptide sequence PGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
epidermodysplasia verruciformis 2, Epidermodysplasia verruciformis protein 2, EV2, EVER2MGC102701, EVIN2FLJ43684, FLJ40668, MGC40121, transmembrane channel-like 8, transmembrane channel-like protein 8
TMC8
IgG
Affinity Purified
82 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit