Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EVG1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP276489

Catalog No. NBP276489


Add to cart

Description

Description

EVG1 Polyclonal antibody specifically detects EVG1 in Human samples. It is validated for Immunocytochemistry,Immunofluorescence.
Specifications

Specifications

EVG1
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
C22orf23
This antibody was developed against Recombinant Protein corresponding to amino acids: LQCSPTSSQRVLPSKQIASPIYLPPILAARPHLRPANMCQANGAYSREQFKPQATRDLEKEKQRLQNIFATGKDMEERKRKAPPARQKAPAPELDRFEELVKEIQERKEFLADMEALGQGKQYRGIILAEISQKLREMEDIDHRRSEE
100 μL
Primary
84645
Human
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1 - 4 μ/mL
chromosome 22 open reading frame 23, dJ1039K5.6, FLJ32787
Rabbit
IgG
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit