Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EXOD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | EXOD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155303
|
Novus Biologicals
NBP155303 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
EXOD1 Polyclonal specifically detects EXOD1 in Human samples. It is validated for Western Blot.Specifications
| EXOD1 | |
| Polyclonal | |
| Rabbit | |
| A8K979 | |
| 112479 | |
| Synthetic peptides corresponding to ERI2(ERI1 exoribonuclease family member 2) The peptide sequence was selected from the middle region of ERI2 (NP_542394). Peptide sequence LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.1, ERI1 exoribonuclease 2, ERI1 exoribonuclease family member 2, EXOD1, exonuclease domain containing 1, Exonuclease domain-containing protein 1, exoribonuclease 2, KIAA1504enhanced RNAi three prime mRNA exonuclease homolog 2, MGC16943 | |
| ERI2 | |
| IgG | |
| 37 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title