Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Exonuclease 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258299

Catalog No. NBP258299


Add to cart

Description

Description

Exonuclease 1 Polyclonal antibody specifically detects Exonuclease 1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

Exonuclease 1
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
EXOI, exonuclease 1, Exonuclease I, HEX1rad2 nuclease family member, homolog of S. cerevisiae exonuclease 1, hExo1, hExoIEC 3.1
Rabbit
IgG
100 ul
Apoptosis, Cancer, Core ESC Like Genes, DNA Repair, Editing and Processing Endonucleases, Stem Cell Markers, Tumor Suppressors
Primary
9156
Human
Western Blot, Immunocytochemistry, Immunofluorescence
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
EXO1
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LDETAVTDKENNLHESEYGDQEGKRLVDTDVARNSSDDIPNNHIPGDHIPDKATVFTDEESYSFKSSKFTRTISPPTLGTLRSCFSWSGGLGDFSRTPSPSPSTALQQFRRKSDSPTSLPENNMSDVSQLK
Affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only