Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Exportin-T Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Exportin-T |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157176
|
Novus Biologicals
NBP157176 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Exportin-T Polyclonal specifically detects Exportin-T in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.Specifications
| Exportin-T | |
| Unconjugated | |
| RUO | |
| exportin(tRNA), exportin, tRNA (nuclear export receptor for tRNAs), exportin-T, tRNA exportin, XPO3 | |
| XPOT | |
| IgG | |
| Affinity Purified |
| Polyclonal | |
| Rabbit | |
| O43592 | |
| 11260 | |
| Synthetic peptides corresponding to XPOT(exportin, tRNA (nuclear export receptor for tRNAs)) The peptide sequence was selected from the middle region of XPOT. Peptide sequence TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title