Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EZFIT/ZNF71 Antibody, Novus Biologicals™

Name: EZFIT/ZNF71 Antibody, Novus Biologicals&trade;
Brand: Novus Biologicals
SKU: NBP18035820
Price: 204.00 USD

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP18035820UL

View more versions of this product

Catalog No. NBP18035820

$204.00 / Each of 1

Qty

Add to Cart

Description

EZFIT/ZNF71 Polyclonal specifically detects EZFIT/ZNF71 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	EZFIT/ZNF71
Classification	Polyclonal
Dilution	Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.	NP_067039
Gene Symbols	ZNF71
Immunogen	Synthetic peptide directed towards the middle region of human ZNF71. Peptide sequence RCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIH.
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Human
Isotype	IgG

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS & 2% Sucrose. with No Preservative
Gene Alias	endothelial zinc finger protein induced by tumor necrosis factor alpha, Kruppel-related zinc finger protein, zinc finger protein 71 (Cos26), zinc finger protein 71EZFITCos26
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	58491
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Product Suggestions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Spot an opportunity for improvement?

Provide Content Correction

EZFIT/ZNF71 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions