Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAAP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | FAAP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156856
|
Novus Biologicals
NBP156856 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
FAAP Polyclonal specifically detects FAAP in Human samples. It is validated for Western Blot.Specifications
| FAAP | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ankyrin repeat domain 54, C22orf28, chromosome 22 open reading frame 28, DJ149A16.6, EC 6.5.1.3, HSPC117, hypothetical protein LOC51493, novel protein HSPC117, RP1-149A16.6 | |
| C22ORF28 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9Y3I0 | |
| 51493 | |
| Synthetic peptides corresponding to C22ORF28 The peptide sequence was selected from the middle region of C22ORF28. Peptide sequence EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title