Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM101A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17952820UL
Description
FAM101A Polyclonal specifically detects FAM101A in Human samples. It is validated for Western Blot.Specifications
FAM101A | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
EAW98447 | |
FAM101A | |
Synthetic peptide directed towards the middle region of human FAM101AThe immunogen for this antibody is FAM101A. Peptide sequence QLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQ. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
family with sequence similarity 101, member A, FLJ44614 | |
Rabbit | |
Affinity Purified | |
RUO | |
144347 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction