Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM101A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $378.35
Specifications
| Antigen | FAM101A |
|---|---|
| Immunogen | Synthetic peptide directed towards the middle region of human FAM101AThe immunogen for this antibody is FAM101A. Peptide sequence QLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQ. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP17952820 |
Novus Biologicals
NBP17952820UL |
20ul |
Each for $152.22
|
|
NBP179528 |
Novus Biologicals
NBP179528 |
100 ul |
Each for $378.35
|
|
Description
FAM101A Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| FAM101A | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 144347 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptide directed towards the middle region of human FAM101AThe immunogen for this antibody is FAM101A. Peptide sequence QLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQ. | |
| Primary | |
| IgG | |
| family with sequence similarity 101, member A, FLJ44614 | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title