Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM120B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310796100UL
Description
FAM120B Polyclonal specifically detects FAM120B in Human samples. It is validated for Western Blot.Specifications
FAM120B | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
CCPGKIAA0183, Constitutive coactivator of PPARG, Constitutive coactivator of PPAR-gamma, family with sequence similarity 120B, FLJ55614, KIAA1838constitutive coactivator of peroxisome proliferator-activated receptor gamma, PGCC1dJ894D12.1, PPARG constitutive coactivator 1, PPARgamma constitutive coactivator 1, Protein FAM120B | |
The immunogen is a synthetic peptide directed towards the N terminal region of human FAM120B (NP_001273310.1). Peptide sequence KTFTAAGIKLIFFFDGMVEQDKRDEWVKRRLKNNREISRIFHYIKSHKEQ | |
100 μg | |
Lipid and Metabolism | |
84498 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction