Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM126A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17980020UL

 View more versions of this product

Catalog No. NBP17980020


Add to cart

Description

Description

FAM126A Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

FAM126A
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
FAM126A
Synthetic peptide directed towards the C terminal of human FAM126AThe immunogen for this antibody is FAM126A. Peptide sequence MEISEVDEGFYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGG.
57 kDa
20ul
Signal Transduction
Primary
84668
Western Blot
Western Blot 0.2-1 ug/ml
NP_115970
Down-regulated by CTNNB1 protein A, DRCTNNB1Aa, family with sequence similarity 126, member A, HLD5, hyccin, Protein FAM126A
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit