Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM130A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258064

Catalog No. NBP258064


Add to cart

Description

Description

FAM130A1 Polyclonal antibody specifically detects FAM130A1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

FAM130A1
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
C12ORF2, C12orf22, CSRNP-2, cysteine/serine-rich nuclear protein 2, cysteine-serine-rich nuclear protein 2, FAM130A1, family with sequence similarity 130, member A1, FLJ25576, Protein FAM130A1, TAIP12, TAIP-12chromosome 12 open reading frame 22, TGF-beta-induced apoptosis protein 12
Rabbit
IgG
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Western Blot, Immunocytochemistry, Immunofluorescence
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
CSRNP2
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVCILEEPLAVPEELCPGLTAPILIQAQLPPGSSVLCFTENSDHPTASTVNSPSYLNSGPLVYYQVEQRPVLGVKG
Affinity purified
RUO
Primary
81566
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only