Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM131B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310724100UL
Description
FAM131B Polyclonal specifically detects FAM131B in Human samples. It is validated for Western Blot.Specifications
FAM131B | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
family with sequence similarity 131, member B, KIAA0773hypothetical protein LOC9715 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM131B. Peptide sequence IEWQGWGKTPAVQPQHSHESVRRDTDAYSDLSDGEKEARFLAGVMEQFAI | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
9715 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
missing translation for 'provideContentCorrection'
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
missing translation for 'productTitle'
Spot an opportunity for improvement?
missing translation for 'provideContentCorrection'