Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM131C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17960720UL

 View more versions of this product

Catalog No. NBP17960720

Add to cart



FAM131C Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


Affinity Purified
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Western Blot 0.2-1 ug/ml
PBS and 2% Sucrose with 0.09% Sodium Azide
C1orf117, family with sequence similarity 131, member C, FLJ36766, hypothetical protein LOC348487, RP11-5P18.9
Synthetic peptide directed towards the middle region of human FAM131CThe immunogen for this antibody is FAM131C. Peptide sequence RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF.
Immunogen affinity purified
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit