Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM134C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16010420UL
Description
FAM134C Polyclonal specifically detects FAM134C in Human samples. It is validated for Western Blot.Specifications
FAM134C | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q86VR2 | |
FAM134C | |
Synthetic peptides corresponding to FAM134C(family with sequence similarity 134, member C) The peptide sequence was selected from the N terminal of FAM134C. Peptide sequence EAAQRALVEVLGPYEPLLSRVQAALVWERPARSALWCLGLNAAFWFFALT. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp686B1036, family with sequence similarity 134, member C, FLJ33806, hypothetical protein LOC162427 | |
Rabbit | |
Affinity Purified | |
RUO | |
162427 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction