FAM160B1 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157822

Catalog No. NBP157822

Description

FAM160B1 Polyclonal specifically detects FAM160B1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FAM160B1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A0JPG1
• Gene Symbols: FAM160B1
• Immunogen: Synthetic peptides corresponding to FAM160B1 (family with sequence similarity 160, member B1) Antibody(against the N terminal of FAM160B1. Peptide sequence HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%.
• Target Species: Human, Mouse, Rat, Amphibian, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp686D10123, family with sequence similarity 160, member B1, hypothetical protein LOC57700, KIAA1600bA106M7.3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57700
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.