Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM160B1 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen FAM160B1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157822
View Documents
Novus Biologicals
NBP157822
100 μL
Each for $436.00
Add to cart
 
NBP15782220
View Documents
Novus Biologicals
NBP15782220UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

FAM160B1 Polyclonal specifically detects FAM160B1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

FAM160B1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
DKFZp686D10123, family with sequence similarity 160, member B1, hypothetical protein LOC57700, KIAA1600bA106M7.3
FAM160B1
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
A0JPG1
57700
Synthetic peptides corresponding to FAM160B1 (family with sequence similarity 160, member B1) Antibody(against the N terminal of FAM160B1. Peptide sequence HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit