Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM160B1 Rabbit, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | FAM160B1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157822
|
Novus Biologicals
NBP157822 |
100 μL |
Each for $436.00
|
|
NBP15782220
|
Novus Biologicals
NBP15782220UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
FAM160B1 Polyclonal specifically detects FAM160B1 in Human samples. It is validated for Western Blot.Specifications
| FAM160B1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp686D10123, family with sequence similarity 160, member B1, hypothetical protein LOC57700, KIAA1600bA106M7.3 | |
| FAM160B1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| A0JPG1 | |
| 57700 | |
| Synthetic peptides corresponding to FAM160B1 (family with sequence similarity 160, member B1) Antibody(against the N terminal of FAM160B1. Peptide sequence HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title