Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM161B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | FAM161B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15672220
|
Novus Biologicals
NBP15672220UL |
20 μL |
Each for $152.22
|
|
NBP156722
|
Novus Biologicals
NBP156722 |
100 μL |
Each for $436.00
|
|
Description
FAM161B Polyclonal specifically detects FAM161B in Human samples. It is validated for Western Blot.Specifications
| FAM161B | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| c14_5547, C14orf44, chromosome 14 open reading frame 44, family with sequence similarity 161, member B, FLJ31697, hypothetical protein LOC145483 | |
| FAM161B | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96MY7 | |
| 145483 | |
| Synthetic peptides corresponding to C14ORF44 The peptide sequence was selected from the middle region of C14ORF44. Peptide sequence AMDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title