Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM161B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen FAM161B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15672220
View Documents
Novus Biologicals
NBP15672220UL
20 μL
Each for $152.22
Add to cart
 
NBP156722
View Documents
Novus Biologicals
NBP156722
100 μL
Each for $436.00
Add to cart
 
Description

Description

FAM161B Polyclonal specifically detects FAM161B in Human samples. It is validated for Western Blot.
Specifications

Specifications

FAM161B
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
c14_5547, C14orf44, chromosome 14 open reading frame 44, family with sequence similarity 161, member B, FLJ31697, hypothetical protein LOC145483
FAM161B
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q96MY7
145483
Synthetic peptides corresponding to C14ORF44 The peptide sequence was selected from the middle region of C14ORF44. Peptide sequence AMDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQ.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit