Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM174B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191565

 View more versions of this product

Catalog No. NBP191565


Add to cart

Description

Description

FAM174B Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

FAM174B
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
FAM174B
Synthetic peptide directed towards the C terminal of human LOC400451. Peptide sequence FTTLLIACLLLRVFRSGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDED.
Protein A purified
RUO
Primary
400451
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
NP_997329
family with sequence similarity 174, member B
Rabbit
IgG
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%.
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit