Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM183BP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309718100UL
Description
FAM183BP Polyclonal specifically detects FAM183BP in Human samples. It is validated for Western Blot.Specifications
FAM183BP | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Rabbit | |
Affinity purified | |
RUO | |
340286 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM183B (NP_001098752). Peptide sequence QTENQEIGWDSEALVDPERRDHRMNHFRVYSDITLYKAKMWSLGEDDRHK | |
100 μg | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction