Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM45B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179665
Description
FAM45B Polyclonal specifically detects FAM45B in Human samples. It is validated for Western Blot.Specifications
FAM45B | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
FAM45B family with sequence similarity 45, member B (pseudogene), HT011 | |
Rabbit | |
Affinity Purified | |
RUO | |
55855 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FAM45B | |
Synthetic peptide directed towards the middle region of human FAM45BThe immunogen for this antibody is FAM45B. Peptide sequence AEDPEKSESQVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKR. | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title